Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TYK2 Peptide - C-terminal region

TYK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

JTK1

UniProt

P29597

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_003322

Preservative

Lyophilized powder

AA Sequence

HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASIC3 Rabbit Polyclonal Antibody
TA371253 100 µL

ASIC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ALS2CR8 (CARF) activation kit by CRISPRa
GA112635 1 Kit

Human ALS2CR8 (CARF) activation kit by CRISPRa

Sign In for Pricing
View Details
Ceturegel™ Matrix for Organoid culture, GFR, Phenol Red-Free, LDEV-Free
40191ES10 10 mL

Ceturegel™ Matrix for Organoid culture, GFR, Phenol Red-Free, LDEV-Free

Sign In for Pricing
View Details
Human TMTC2 activation kit by CRISPRa
GA115998 1 Kit

Human TMTC2 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Tbp7 Antibody
RC-16605-01 50 μL

Recombinant Tbp7 Antibody

Sign In for Pricing
View Details
Recombinant Tbp7 Antibody
RC-16605-02 100 µL

Recombinant Tbp7 Antibody

Sign In for Pricing
View Details