Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UACA Peptide - C-terminal region

UACA Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ10128, KIAA1561, MGC141967, MGC141969, NUCLING

UniProt

Q9BZF9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UACA Rabbit Polyclonal Antibody (orb585219) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008225

Preservative

Lyophilized powder

AA Sequence

TELLNDVERLKQALNGLSQLTYTSGNPTKRQSQLIDTLQHQVKSLEQQLA

More Discoveries

Explore Other Products

Browse additional items from our catalog

STX12 Protein Lysate (Human) with C-Ha Tag
45789031 100 µg

STX12 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
ARHGAP18 Antibody
MBS9414374-01 0.1 mL

ARHGAP18 Antibody

Sign In for Pricing
View Details
ARHGAP18 Antibody
MBS9414374-02 5x 0.1 mL

ARHGAP18 Antibody

Sign In for Pricing
View Details
Dnajc21 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
18402114 3x 1.0 µg

Dnajc21 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Bovine Pasteurella Multocida Antibody IgM (PTM-IgM) ELISA Kit
SL0011Bo-01 48 Tests

Bovine Pasteurella Multocida Antibody IgM (PTM-IgM) ELISA Kit

Sign In for Pricing
View Details
Bovine Pasteurella Multocida Antibody IgM (PTM-IgM) ELISA Kit
SL0011Bo-02 96 Tests

Bovine Pasteurella Multocida Antibody IgM (PTM-IgM) ELISA Kit

Sign In for Pricing
View Details