Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UACA Peptide - C-terminal region

UACA Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ10128, KIAA1561, MGC141967, MGC141969, NUCLING

UniProt

Q9BZF9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UACA Rabbit Polyclonal Antibody (orb585219) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008225

Preservative

Lyophilized powder

AA Sequence

TELLNDVERLKQALNGLSQLTYTSGNPTKRQSQLIDTLQHQVKSLEQQLA

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX6-3 Antibody - middle region : Biotin (ARP39907_P050-Biotin)
ARP39907_P050-Biotin 100 µL

NKX6-3 Antibody - middle region : Biotin (ARP39907_P050-Biotin)

Sign In for Pricing
View Details
LRP1, CT (Prolow-density Lipoprotein Receptor-related Protein 1, LRP-1, Alpha-2-macroglobulin Receptor, A2MR, Apolipoprotein E Receptor, APOER, CD91, APR) (AP) discontinued
L2601-05J-AP 200 µL

LRP1, CT (Prolow-density Lipoprotein Receptor-related Protein 1, LRP-1, Alpha-2-macroglobulin Receptor, A2MR, Apolipoprotein E Receptor, APOER, CD91, APR) (AP) discontinued

Sign In for Pricing
View Details
4930404N11Rik (NM_001014836) Mouse Tagged ORF Clone
MR213961 10 µg

4930404N11Rik (NM_001014836) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Goose Interleukin 1 Epsilon ELISA Kit
MBS067768 Inquire

Goose Interleukin 1 Epsilon ELISA Kit

Sign In for Pricing
View Details
Anti-GAB2 Antibody (R4B16)
RHN93901 100 μg

Anti-GAB2 Antibody (R4B16)

Sign In for Pricing
View Details
anti-ROR alpha
YF-PA24594 50 ul

anti-ROR alpha

Sign In for Pricing
View Details