Uap1l1 Peptide - middle region
Uap1l1 Peptide - middle region
Product Specifications
Product Name Alternative
5730445F03Rik
UniProt
Q3TW96
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Uap1l1 Rabbit Polyclonal Antibody (orb580673) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001028465
Preservative
Lyophilized powder
AA Sequence
KVPYVDEEGNLVKPLRPNGIKMEKFVFDVFQFAKNFVAFEVCREEEFSPL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Recombinant Herminiimonas arsenicoxydans GMP synthase [glutamine-hydrolyzing] (guaA), partial](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
MBS1214361 Inquire
Recombinant Herminiimonas arsenicoxydans GMP synthase [glutamine-hydrolyzing] (guaA), partial
Sign In for Pricing
View Details MBS6480288-01 0.1 mL
Hexosaminidase A. NT (Hexosaminidase Subunit A, HEXA, Beta-hexosaminidase Subunit alpha, Beta-N-acetylhexosaminidase Subunit alpha, MGC99608, N-acetyl-beta-glucosaminidase Subunit alpha, TSD) (MaxLight 405)
Sign In for Pricing
View Details MBS6480288-02 5x 0.1 mL
Hexosaminidase A. NT (Hexosaminidase Subunit A, HEXA, Beta-hexosaminidase Subunit alpha, Beta-N-acetylhexosaminidase Subunit alpha, MGC99608, N-acetyl-beta-glucosaminidase Subunit alpha, TSD) (MaxLight 405)
Sign In for Pricing
View Details 