Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBA6 Peptide - middle region

UBA6 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ10808, FLJ23367, MOP-4, UBE1L2, E1-L2

UniProt

A0AVT1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBA6 Rabbit Polyclonal Antibody (orb584318) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060697

Preservative

Lyophilized powder

AA Sequence

EVIVPHLTESYNSHRDPPEEEIPFCTLKSFPAAIEHTIQWARDKFESSFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf172 Polyclonal Antibody
orb1419688 100 µL

C9orf172 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit polyclonal PKC theta antibody
MBS5304960-01 0.05 mg

Rabbit polyclonal PKC theta antibody

Sign In for Pricing
View Details
Rabbit polyclonal PKC theta antibody
MBS5304960-02 5x 0.05 mg

Rabbit polyclonal PKC theta antibody

Sign In for Pricing
View Details
Hydrochloric acid fuming 37 % p.A., ACS
LC-7093.3 25 L

Hydrochloric acid fuming 37 % p.A., ACS

Sign In for Pricing
View Details
CM1, Recombinant, Arabidopsis Thaliana, aa3-247, His-Tag (Chorismate Mutase, Chloroplastic)
372797-01 20 µg

CM1, Recombinant, Arabidopsis Thaliana, aa3-247, His-Tag (Chorismate Mutase, Chloroplastic)

Sign In for Pricing
View Details
CM1, Recombinant, Arabidopsis Thaliana, aa3-247, His-Tag (Chorismate Mutase, Chloroplastic)
372797-02 100 µg

CM1, Recombinant, Arabidopsis Thaliana, aa3-247, His-Tag (Chorismate Mutase, Chloroplastic)

Sign In for Pricing
View Details