Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBA6 Peptide - middle region

UBA6 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ10808, FLJ23367, MOP-4, UBE1L2, E1-L2

UniProt

A0AVT1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBA6 Rabbit Polyclonal Antibody (orb584318) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060697

Preservative

Lyophilized powder

AA Sequence

EVIVPHLTESYNSHRDPPEEEIPFCTLKSFPAAIEHTIQWARDKFESSFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

V5 tag Rabbit pAb, PE-Cy5 conjugated
orb892217 100 µL

V5 tag Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
Ubiquitin Carboxyl Terminal Hydrolase L1 (UCHL1) Mouse ELISA Kit
I0059 96 Tests

Ubiquitin Carboxyl Terminal Hydrolase L1 (UCHL1) Mouse ELISA Kit

Sign In for Pricing
View Details
GST tag Rabbit pAb, BF350 conjugated
orb2455962 100 µL

GST tag Rabbit pAb, BF350 conjugated

Sign In for Pricing
View Details
Sheep Beta-Lipotropic Hormone ELISA Kit
MBS050926-01 48 Well

Sheep Beta-Lipotropic Hormone ELISA Kit

Sign In for Pricing
View Details
Sheep Beta-Lipotropic Hormone ELISA Kit
MBS050926-02 96 Well

Sheep Beta-Lipotropic Hormone ELISA Kit

Sign In for Pricing
View Details
Sheep Beta-Lipotropic Hormone ELISA Kit
MBS050926-03 5x 96 Well

Sheep Beta-Lipotropic Hormone ELISA Kit

Sign In for Pricing
View Details