Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2C Peptide - middle region

UBE2C Peptide - middle region

Product Specifications

Product Name Alternative

UBCH10, dJ447F3.2

UniProt

O00762

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBE2C Rabbit Polyclonal Antibody (orb330300) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_861515

Preservative

Lyophilized powder

AA Sequence

GTAVGSIRTSSTVCLLSGPRETQDSSKPLVWGLGWDMRLLLELTLQLFLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin L rabbit pAb Antibody
orb766729-01 50 μL

Cathepsin L rabbit pAb Antibody

Sign In for Pricing
View Details
Cathepsin L rabbit pAb Antibody
orb766729-02 100 µL

Cathepsin L rabbit pAb Antibody

Sign In for Pricing
View Details
CD19 Antibody
orb607865-01 20 µg

CD19 Antibody

Sign In for Pricing
View Details
CD19 Antibody
orb607865-02 100 µg

CD19 Antibody

Sign In for Pricing
View Details
CD19 Antibody
orb607865-03 100 ug (without BSA and Azide)

CD19 Antibody

Sign In for Pricing
View Details
Mouse Calcium Sensing Receptor (CASR) Antibody Pair Kit (with Standard)
MBS2101640-01 5x 96 Tests

Mouse Calcium Sensing Receptor (CASR) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details