Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2C Peptide - middle region

UBE2C Peptide - middle region

Product Specifications

Product Name Alternative

UBCH10, dJ447F3.2

UniProt

O00762

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBE2C Rabbit Polyclonal Antibody (orb330300) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_861515

Preservative

Lyophilized powder

AA Sequence

GTAVGSIRTSSTVCLLSGPRETQDSSKPLVWGLGWDMRLLLELTLQLFLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PH Meter (BFU-5202)
BFU-5202 1 Unit

PH Meter (BFU-5202)

Sign In for Pricing
View Details
2-Methyl-6- (methylsulfanyl) aniline
AEA30595-01 50 mg

2-Methyl-6- (methylsulfanyl) aniline

Sign In for Pricing
View Details
2-Methyl-6- (methylsulfanyl) aniline
AEA30595-02 0.5 g

2-Methyl-6- (methylsulfanyl) aniline

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana GDSL esterase/lipase At3g27950 (At3g27950)
MBS1377723-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana GDSL esterase/lipase At3g27950 (At3g27950)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana GDSL esterase/lipase At3g27950 (At3g27950)
MBS1377723-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana GDSL esterase/lipase At3g27950 (At3g27950)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana GDSL esterase/lipase At3g27950 (At3g27950)
MBS1377723-03 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana GDSL esterase/lipase At3g27950 (At3g27950)

Sign In for Pricing
View Details