Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2F Peptide - middle region

UBE2F Peptide - middle region

Product Specifications

Product Name Alternative

MGC18120, NCE2

UniProt

Q969M7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBE2F Rabbit Polyclonal Antibody (orb581730) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542409

Preservative

Lyophilized powder

AA Sequence

TLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYA

More Discoveries

Explore Other Products

Browse additional items from our catalog

FXYD3 AAV siRNA Pooled Vector
21094161 1.0 µg

FXYD3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Anti-Sortilin antibody
STJ13100315 100 µl

Anti-Sortilin antibody

Sign In for Pricing
View Details
CD4 Monoclonal Antibody
ANT-11208-50ug 50 µg

CD4 Monoclonal Antibody

Sign In for Pricing
View Details
TBCA (h) : 293T Lysate
sc-113020 100 µg - 200 µL

TBCA (h) : 293T Lysate

Sign In for Pricing
View Details
Adamtsl2 Mouse Gene Knockout Kit (CRISPR)
KN500868 1 Kit

Adamtsl2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse DHFR Antibody (C-term)
E45R08490G-1 100 µL

Mouse DHFR Antibody (C-term)

Sign In for Pricing
View Details