Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2F Peptide - middle region

UBE2F Peptide - middle region

Product Specifications

Product Name Alternative

MGC18120, NCE2

UniProt

Q969M7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBE2F Rabbit Polyclonal Antibody (orb581730) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542409

Preservative

Lyophilized powder

AA Sequence

TLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYA

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Aspergillus oryzae Putative DNA helicase ino80 (ino80), partial
MBS1320468 Inquire

Recombinant Aspergillus oryzae Putative DNA helicase ino80 (ino80), partial

Sign In for Pricing
View Details
Recombinant Human TIMM10B Protein, His-SUMO, E.coli-10ug
QP8270-ec-10ug 10ug

Recombinant Human TIMM10B Protein, His-SUMO, E.coli-10ug

Sign In for Pricing
View Details
Mouse Monoclonal FoxP3 Antibody (3G3) [DyLight 350]
NB100-56582UV 0.1 mL

Mouse Monoclonal FoxP3 Antibody (3G3) [DyLight 350]

Sign In for Pricing
View Details
Anti-OXCT1/SCOT Antibody Picoband®, Dylight550 Conjugate
A07229-1-Dylight550 100 µg

Anti-OXCT1/SCOT Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
Human ZNF780A (NM_001142577) AAV Particle
RC227849A1V 250 µL

Human ZNF780A (NM_001142577) AAV Particle

Sign In for Pricing
View Details
Bromoacetic Acid-d2
TRC-B679082-1G 1 g

Bromoacetic Acid-d2

Sign In for Pricing
View Details