Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ube2g1 Peptide - N-terminal region

Ube2g1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2700059C12Rik, AI256795, AU014992, AW552068, D130023C12Rik

UniProt

P62254

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ube2g1 Rabbit Polyclonal Antibody (orb578684) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080261

Preservative

Lyophilized powder

AA Sequence

GPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elastin (ELN) (NM_001278916) Human Tagged ORF Clone
RG239238 10 µg

Elastin (ELN) (NM_001278916) Human Tagged ORF Clone

Sign In for Pricing
View Details
Romosozumab Biosimilar - Research Grade
ICH5108-100mg 100 mg

Romosozumab Biosimilar - Research Grade

Sign In for Pricing
View Details
CDC27 Mouse Monoclonal Antibody [Clone ID: 5C12]
AM06470SU-N 100 µL

CDC27 Mouse Monoclonal Antibody [Clone ID: 5C12]

Sign In for Pricing
View Details
Adam1a Mouse Gene Knockout Kit (CRISPR)
KN500821 1 Kit

Adam1a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GLUT4 (SLC2A4) Rabbit Polyclonal Antibody
TA381634 100 µL

GLUT4 (SLC2A4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ELMO3 activation kit by CRISPRa
GA112611 1 Kit

Human ELMO3 activation kit by CRISPRa

Sign In for Pricing
View Details