Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ube2g1 Peptide - N-terminal region

Ube2g1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2700059C12Rik, AI256795, AU014992, AW552068, D130023C12Rik

UniProt

P62254

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ube2g1 Rabbit Polyclonal Antibody (orb578684) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080261

Preservative

Lyophilized powder

AA Sequence

GPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MycoLight™ Green JJ98 *5 mM in DMSO*
24000-AAT 100 µL

MycoLight™ Green JJ98 *5 mM in DMSO*

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS804891 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
Cholesterol-d4
TRC-C432504-25MG 25 mg

Cholesterol-d4

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR559543 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
LRP2 Rabbit Polyclonal Antibody
AP10448PU-N 100 µg

LRP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N-Ethyl-N-benzylaniline-3'-sulfonic Acid Monohydrate
TRC-E937576-500MG 500 mg

N-Ethyl-N-benzylaniline-3'-sulfonic Acid Monohydrate

Sign In for Pricing
View Details