Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2O Peptide - middle region

UBE2O Peptide - middle region

Product Specifications

Product Name Alternative

E2-230K, FLJ12878, KIAA1734

UniProt

Q9C0C9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBE2O Rabbit Polyclonal Antibody (orb583623) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071349

Preservative

Lyophilized powder

AA Sequence

YNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CGP77675 hydrate
MBS5802418 Inquire

CGP77675 hydrate

Sign In for Pricing
View Details
FZR1 Rabbit Polyclonal Antibody
orb327295 100 µL

FZR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Leptospira Biflexa nuoD protein (aa 1-406) (strain Patoc 1 / ATCC 23582 / Paris)
VAng-Wyb0121-1mgEcoli 1 mg (E. coli)

Recombinant Leptospira Biflexa nuoD protein (aa 1-406) (strain Patoc 1 / ATCC 23582 / Paris)

Sign In for Pricing
View Details
Cytotoxic T-Lymphocyte Associated Antigen 4 (CTLA4) Polyclonal Antibody
CAU26313-01 100 µL

Cytotoxic T-Lymphocyte Associated Antigen 4 (CTLA4) Polyclonal Antibody

Sign In for Pricing
View Details
Cytotoxic T-Lymphocyte Associated Antigen 4 (CTLA4) Polyclonal Antibody
CAU26313-02 200 µL

Cytotoxic T-Lymphocyte Associated Antigen 4 (CTLA4) Polyclonal Antibody

Sign In for Pricing
View Details
Cytotoxic T-Lymphocyte Associated Antigen 4 (CTLA4) Polyclonal Antibody
CAU26313-03 1 mL

Cytotoxic T-Lymphocyte Associated Antigen 4 (CTLA4) Polyclonal Antibody

Sign In for Pricing
View Details