Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2O Peptide - middle region

UBE2O Peptide - middle region

Product Specifications

Product Name Alternative

E2-230K, FLJ12878, KIAA1734

UniProt

Q9C0C9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBE2O Rabbit Polyclonal Antibody (orb583623) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071349

Preservative

Lyophilized powder

AA Sequence

YNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Carbonic anhydrase-related protein 10 (CA10) ELISA Kit
MBS7244542-01 48 Well

Mouse Carbonic anhydrase-related protein 10 (CA10) ELISA Kit

Sign In for Pricing
View Details
Mouse Carbonic anhydrase-related protein 10 (CA10) ELISA Kit
MBS7244542-02 96 Well

Mouse Carbonic anhydrase-related protein 10 (CA10) ELISA Kit

Sign In for Pricing
View Details
Mouse Carbonic anhydrase-related protein 10 (CA10) ELISA Kit
MBS7244542-03 5x 96 Well

Mouse Carbonic anhydrase-related protein 10 (CA10) ELISA Kit

Sign In for Pricing
View Details
Mouse Carbonic anhydrase-related protein 10 (CA10) ELISA Kit
MBS7244542-04 10x 96 Well

Mouse Carbonic anhydrase-related protein 10 (CA10) ELISA Kit

Sign In for Pricing
View Details
Brcc3 AAV siRNA Pooled Vector
13456166 1.0 µg

Brcc3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
EWSR1 (Ewing Sarcoma Breakpoint Region 1 Protein, EWS Oncogene, RNA-binding Protein EWS, EWS, bK984G1.4, CAGF29) (MaxLight 650)
126496-ML650 100 µL

EWSR1 (Ewing Sarcoma Breakpoint Region 1 Protein, EWS Oncogene, RNA-binding Protein EWS, EWS, bK984G1.4, CAGF29) (MaxLight 650)

Sign In for Pricing
View Details