Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2Q1 Peptide - middle region

UBE2Q1 Peptide - middle region

Product Specifications

Product Name Alternative

GTAP, NICE-5, PRO3094, UBE2Q

UniProt

Q7Z7E8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBE2Q1 Rabbit Polyclonal Antibody (orb585476) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060052

Preservative

Lyophilized powder

AA Sequence

PLPAEQCTQEDVSSEDEDEEMPEDTEDLDHYEMKEEEPAEGKKSEDDGIG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bacillus subtilis Uncharacterized membrane protein yubF (yubF)
MBS7035559-01 0.02 mg

Recombinant Bacillus subtilis Uncharacterized membrane protein yubF (yubF)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized membrane protein yubF (yubF)
MBS7035559-02 0.1 mg

Recombinant Bacillus subtilis Uncharacterized membrane protein yubF (yubF)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized membrane protein yubF (yubF)
MBS7035559-03 5x 0.1 mg

Recombinant Bacillus subtilis Uncharacterized membrane protein yubF (yubF)

Sign In for Pricing
View Details
Mouse Lnpep ELISA Kit
EF015370 96 Tests

Mouse Lnpep ELISA Kit

Sign In for Pricing
View Details
HSPABP/HIP/HSC70 Interacting Protein HIP Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-11271R-BF405 100 µL

HSPABP/HIP/HSC70 Interacting Protein HIP Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
BUB1 CRISPR Activation Plasmid (h2)
sc-402006-ACT-2 20 µg

BUB1 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details