Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2Q1 Peptide - middle region

UBE2Q1 Peptide - middle region

Product Specifications

Product Name Alternative

GTAP, NICE-5, PRO3094, UBE2Q

UniProt

Q7Z7E8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBE2Q1 Rabbit Polyclonal Antibody (orb585476) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060052

Preservative

Lyophilized powder

AA Sequence

PLPAEQCTQEDVSSEDEDEEMPEDTEDLDHYEMKEEEPAEGKKSEDDGIG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCRL1P1 Protein Lysate (Human) with C-Ha Tag
15436031 100 µg

CCRL1P1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Human Ghrelin/Obestatin Preprohormone (GHRL) ELISA Kit
EKU04367 96 Tests

Human Ghrelin/Obestatin Preprohormone (GHRL) ELISA Kit

Sign In for Pricing
View Details
Tlr5 Rat shRNA Plasmid (Locus ID 289337)
TR709135 1 Kit

Tlr5 Rat shRNA Plasmid (Locus ID 289337)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum M-phase inducer phosphatase (cdc25), partial
MBS1458350 Inquire

Recombinant Dictyostelium discoideum M-phase inducer phosphatase (cdc25), partial

Sign In for Pricing
View Details
AU015228 3'UTR GFP Stable Cell Line
TU152394 1.0 mL

AU015228 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MATK Antibody
E19-4775 100 µg -100 µL

MATK Antibody

Sign In for Pricing
View Details