Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2Z Peptide - C-terminal region

UBE2Z Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ13855, HOYS7, USE1

UniProt

Q9H832

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBE2Z Rabbit Polyclonal Antibody (orb585478) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075567

Preservative

Lyophilized powder

AA Sequence

GEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sucla2 (NM_011506) Mouse Tagged ORF Clone Lentiviral Particle
MR207397L3V 200 µL

Sucla2 (NM_011506) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SP1 Polyclonal Antibody
MBS8569355-01 0.1 mL

SP1 Polyclonal Antibody

Sign In for Pricing
View Details
SP1 Polyclonal Antibody
MBS8569355-02 0.1 mL (AF405L)

SP1 Polyclonal Antibody

Sign In for Pricing
View Details
SP1 Polyclonal Antibody
MBS8569355-03 0.1 mL (AF405S)

SP1 Polyclonal Antibody

Sign In for Pricing
View Details
SP1 Polyclonal Antibody
MBS8569355-04 0.1 mL (AF610)

SP1 Polyclonal Antibody

Sign In for Pricing
View Details
SP1 Polyclonal Antibody
MBS8569355-05 0.1 mL (AF635)

SP1 Polyclonal Antibody

Sign In for Pricing
View Details