Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2Z Peptide - C-terminal region

UBE2Z Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ13855, HOYS7, USE1

UniProt

Q9H832

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBE2Z Rabbit Polyclonal Antibody (orb585478) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075567

Preservative

Lyophilized powder

AA Sequence

GEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTBP1 Conjugated Antibody
C43006 100 µL

PTBP1 Conjugated Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal B7-H3/CD276 Antibody
NBP2-32251 100 µL

Rabbit Polyclonal B7-H3/CD276 Antibody

Sign In for Pricing
View Details
M CD274 / PDL1 (6His) Expression Lentivirus
LVP1418 1x 10^7 IFU/mL - 200 μL

M CD274 / PDL1 (6His) Expression Lentivirus

Sign In for Pricing
View Details
Recombinant Human CD227/MUC1 Protein, N-His
YHD14201 100 μg

Recombinant Human CD227/MUC1 Protein, N-His

Sign In for Pricing
View Details
SNX20 Rabbit Polyclonal Antibody (FITC)
orb2985328 100 µg

SNX20 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CGP52432
S0303-100mg 100 mg

CGP52432

Sign In for Pricing
View Details