Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubl3 Peptide - C-terminal region

Ubl3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC109350

UniProt

Q5BJT2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ubl3 Rabbit Polyclonal Antibody (orb330889) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001015030

Preservative

Lyophilized powder

AA Sequence

FLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spiromesifen
TRC-S683505-250MG 250 mg

Spiromesifen

Sign In for Pricing
View Details
CD34 (HPCA1/1171), CF640R conjugate, 0.1mg/mL
BNC401171-500 1x 500 µL

CD34 (HPCA1/1171), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Gt(ROSA)26Sor activation kit by CRISPRa
GA201779 1 Kit

Mouse Gt(ROSA)26Sor activation kit by CRISPRa

Sign In for Pricing
View Details
PAPP A (PAPPA) Human Gene Knockout Kit (CRISPR)
KN209767 1 Kit

PAPP A (PAPPA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PDZK1 (Center) Rabbit Polyclonal Antibody
AP53250PU-N 400 µL

PDZK1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCDC61 (N-term) Rabbit Polyclonal Antibody
AP50786PU-N 400 µL

CCDC61 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details