Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubl3 Peptide - C-terminal region

Ubl3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC109350

UniProt

Q5BJT2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ubl3 Rabbit Polyclonal Antibody (orb330889) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001015030

Preservative

Lyophilized powder

AA Sequence

FLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTF2 Human Gene Knockout Kit (CRISPR)
KN220957BN 1 Kit

TTF2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human RNF19B activation kit by CRISPRa
GA115001 1 Kit

Human RNF19B activation kit by CRISPRa

Sign In for Pricing
View Details
Folate Receptor 4 (IZUMO1R) (N-term) Rabbit Polyclonal Antibody
AP51698PU-N 400 µL

Folate Receptor 4 (IZUMO1R) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
7-Hydroxy-1,4-benzodioxan-6-carboxylic Acid
TRC-H829190-25MG 25 mg

7-Hydroxy-1,4-benzodioxan-6-carboxylic Acid

Sign In for Pricing
View Details
Recombinant CCR3 Antibody
RC-16399-01 50 μL

Recombinant CCR3 Antibody

Sign In for Pricing
View Details
Recombinant CCR3 Antibody
RC-16399-02 100 µL

Recombinant CCR3 Antibody

Sign In for Pricing
View Details