UBL4A Peptide - middle region
UBL4A Peptide - middle region
Product Specifications
Product Name Alternative
DX254E, DXS254E, G6PD, GDX, UBL4, GET5, MDY2, TMA24
UniProt
B7NZQ9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_055050
Preservative
Lyophilized powder
AA Sequence
EGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6426490-01 0.1 mL
MEF2A, Phosphorylated (T319) (Myocyte-specific Enhancer Factor 2A, Mef2, ADCAD1, RSRFC4, RSRFC9) (MaxLight 405)
Sign In for Pricing
View Details MBS6426490-02 5x 0.1 mL
MEF2A, Phosphorylated (T319) (Myocyte-specific Enhancer Factor 2A, Mef2, ADCAD1, RSRFC4, RSRFC9) (MaxLight 405)
Sign In for Pricing
View Details 
041235-ML490 100 µL
RPS15A, NT (RPS15A, 40S ribosomal protein S15a) (MaxLight 490) discontinued
Sign In for Pricing
View Details 
VAng-Wyb1816-50gEcoli 50 µg (E. coli)
Recombinant Yersinia Enterocolitica rpsS Protein (aa 1-92) (strain 8081)
Sign In for Pricing
View Details K2296505 3x 1.0 µg
ST8SIA2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details