Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBL4A Peptide - middle region

UBL4A Peptide - middle region

Product Specifications

Product Name Alternative

DX254E, DXS254E, G6PD, GDX, UBL4, GET5, MDY2, TMA24

UniProt

B7NZQ9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055050

Preservative

Lyophilized powder

AA Sequence

EGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prothrombin Complex Protein
abx263073-01 10 IU

Prothrombin Complex Protein

Sign In for Pricing
View Details
Prothrombin Complex Protein
abx263073-02 50 IU

Prothrombin Complex Protein

Sign In for Pricing
View Details
Prothrombin Complex Protein
abx263073-03 300 IU

Prothrombin Complex Protein

Sign In for Pricing
View Details
Duazomycin sodium
orb3135674-01 10 mg

Duazomycin sodium

Sign In for Pricing
View Details
Duazomycin sodium
orb3135674-02 50 mg

Duazomycin sodium

Sign In for Pricing
View Details
CRYBB2 (NM_000496) Human Recombinant Protein
TP310125M 100 µg

CRYBB2 (NM_000496) Human Recombinant Protein

Sign In for Pricing
View Details