What is the catalog number for UBL4A Peptide - C-terminal region?

The catalog number for UBL4A Peptide - C-terminal region is orb2008542.

What sizes are available for UBL4A Peptide - C-terminal region?

UBL4A Peptide - C-terminal region is available in the following size(s): 100 µg.

Is UBL4A Peptide - C-terminal region in stock?

UBL4A Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

UBL4A Peptide - C-terminal region

Product Specifications

Product Name Alternative

DX254E, DXS254E, G6PD, GDX, UBL4, GET5, MDY2, TMA24

UniProt

B7NZQ9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055050

Preservative

Lyophilized powder

AA Sequence

SAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

50188102 1 µg

VPS39 AAV Vector (Human) (CMV)

Sign In for Pricing

View Details

AM09031PU-N 100 µL

Rab5 (RAB5A) Mouse Monoclonal Antibody [Clone ID: 3A4]

Sign In for Pricing

View Details

MBS734088-01 48 Well

Goat Retinol Binding Protein 4 ELISA Kit

Sign In for Pricing

View Details

MBS734088-02 96 Well

Goat Retinol Binding Protein 4 ELISA Kit

Sign In for Pricing

View Details

MBS734088-03 5x 96 Well

Goat Retinol Binding Protein 4 ELISA Kit

Sign In for Pricing

View Details

MBS734088-04 10x 96 Well

Goat Retinol Binding Protein 4 ELISA Kit

Sign In for Pricing

View Details