Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubl5 Peptide - N-terminal region

Ubl5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Beacon

UniProt

A9UMW0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ubl5 Rabbit Polyclonal Antibody (orb326091) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001041708

Preservative

Lyophilized powder

AA Sequence

CNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E4F1 Protein Lysate (Human) with C-Ha Tag
18848032 100 µg

E4F1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
ARIH1 Recombinant Protein Antigen
NBP1-88984PEP 0.1 mL

ARIH1 Recombinant Protein Antigen

Sign In for Pricing
View Details
Dihydropleuromutilin
orb2283109 5 mg

Dihydropleuromutilin

Sign In for Pricing
View Details
Thrombin Porcine
OM297530-01 1000 U

Thrombin Porcine

Sign In for Pricing
View Details
Thrombin Porcine
OM297530-02 500 U

Thrombin Porcine

Sign In for Pricing
View Details
Thrombin Porcine
OM297530-03 2000 U

Thrombin Porcine

Sign In for Pricing
View Details