Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubl5 Peptide - N-terminal region

Ubl5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Beacon

UniProt

A9UMW0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ubl5 Rabbit Polyclonal Antibody (orb326091) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001041708

Preservative

Lyophilized powder

AA Sequence

CNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PES1 antibody - C-terminal region
MBS3211994-01 0.1 mL

PES1 antibody - C-terminal region

Sign In for Pricing
View Details
PES1 antibody - C-terminal region
MBS3211994-02 5x 0.1 mL

PES1 antibody - C-terminal region

Sign In for Pricing
View Details
Rabbit Polyclonal CDC40 Antibody [FITC]
NBP2-12780F 0.1 mL

Rabbit Polyclonal CDC40 Antibody [FITC]

Sign In for Pricing
View Details
Mini Dry Bath Incubator BDMI-101
BDMI-101 1 Unit

Mini Dry Bath Incubator BDMI-101

Sign In for Pricing
View Details
Recombinant Human Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-14 (GBG14)
orb3004352-01 20 µg

Recombinant Human Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-14 (GBG14)

Sign In for Pricing
View Details
Recombinant Human Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-14 (GBG14)
orb3004352-02 100 µg

Recombinant Human Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-14 (GBG14)

Sign In for Pricing
View Details