Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubox5 Peptide - middle region

Ubox5 Peptide - middle region

Product Specifications

Product Name Alternative

1500010O06Rik, C330018L13Rik, Rnf37, UIP5, Ubce7ip5, Ube7ip5

UniProt

Q925F4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ubox5 Rabbit Polyclonal Antibody (orb578750) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542129

Preservative

Lyophilized powder

AA Sequence

RVPSDPFTGLAFTPQSQPLPHPSLKARIDRFLLQHSISGCRLLGRAQTPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR6790 Human qPCR Primer Pair (MI0022635)
HP301391 200 Reactions

MIR6790 Human qPCR Primer Pair (MI0022635)

Sign In for Pricing
View Details
Mouse PRPF4B shRNA Plasmid
abx972222-01 150 µg

Mouse PRPF4B shRNA Plasmid

Sign In for Pricing
View Details
Mouse PRPF4B shRNA Plasmid
abx972222-02 300 µg

Mouse PRPF4B shRNA Plasmid

Sign In for Pricing
View Details
EXTL2 (NM_001261441) Human Untagged Clone
SC335451 10 µg

EXTL2 (NM_001261441) Human Untagged Clone

Sign In for Pricing
View Details
HT1080/GFP stable cell line
GTR15424036 1 Vial

HT1080/GFP stable cell line

Sign In for Pricing
View Details
Eucamalol
TN4026 5 mg

Eucamalol

Sign In for Pricing
View Details