Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubox5 Peptide - middle region

Ubox5 Peptide - middle region

Product Specifications

Product Name Alternative

1500010O06Rik, C330018L13Rik, Rnf37, UIP5, Ubce7ip5, Ube7ip5

UniProt

Q925F4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ubox5 Rabbit Polyclonal Antibody (orb578750) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542129

Preservative

Lyophilized powder

AA Sequence

RVPSDPFTGLAFTPQSQPLPHPSLKARIDRFLLQHSISGCRLLGRAQTPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAP Polyclonal Antibody, HRP Conjugated
bs-5758R-HRP 100 µL

FAP Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Recombinant Maticora bivirgata Cytochrome b (MT-CYB), partial
MBS7100897 Inquire

Recombinant Maticora bivirgata Cytochrome b (MT-CYB), partial

Sign In for Pricing
View Details
P2X2 Rabbit Polyclonal Antibody (PE)
orb496170 100 µL

P2X2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Anti-RAP1B-Specific antibody
PAab07109 100 µg

Anti-RAP1B-Specific antibody

Sign In for Pricing
View Details
Human OR10AD1 shRNA Plasmid
abx964666-01 150 µg

Human OR10AD1 shRNA Plasmid

Sign In for Pricing
View Details
Human OR10AD1 shRNA Plasmid
abx964666-02 300 µg

Human OR10AD1 shRNA Plasmid

Sign In for Pricing
View Details