Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBQLN4 Peptide - middle region

UBQLN4 Peptide - middle region

Product Specifications

Product Name Alternative

A1U, C1orf6, UBIN, CIP75

UniProt

Q9NRR5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBQLN4 Rabbit Polyclonal Antibody (orb583535) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064516

Preservative

Lyophilized powder

AA Sequence

TDIQEPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sanggenol P
M31355-01 100 mg

Sanggenol P

Sign In for Pricing
View Details
Sanggenol P
M31355-02 50 mg

Sanggenol P

Sign In for Pricing
View Details
Sanggenol P
M31355-03 500 mg

Sanggenol P

Sign In for Pricing
View Details
Sanggenol P
M31355-04 Inquire

Sanggenol P

Sign In for Pricing
View Details
Sanggenol P
M31355-05 5 mg

Sanggenol P

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Inhibin Alpha (INHa)
MBS2163985-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to Inhibin Alpha (INHa)

Sign In for Pricing
View Details