Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBTD1 Peptide - middle region

UBTD1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ11807

UniProt

Q9HAC8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_079230

Preservative

Lyophilized powder

AA Sequence

TEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal anti-mouse TNFSF13B
mAP-0347 50 µg

Rat Monoclonal anti-mouse TNFSF13B

Sign In for Pricing
View Details
Mrps25 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
30569114 3x 1.0 µg

Mrps25 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
FBXO10 Human shRNA Plasmid Kit (Locus ID 26267)
TL313041 1 Kit

FBXO10 Human shRNA Plasmid Kit (Locus ID 26267)

Sign In for Pricing
View Details
Recombinant Human Platelet Glycoprotein IV/SR-B3 Fc Chimera Protein/CD36 (C-Fc)
CP94-500ug 500 µg

Recombinant Human Platelet Glycoprotein IV/SR-B3 Fc Chimera Protein/CD36 (C-Fc)

Sign In for Pricing
View Details
FFU (fan filter unit) BFSD-901
BFSD-901 1 Unit

FFU (fan filter unit) BFSD-901

Sign In for Pricing
View Details
GATA3 CytoSection
TS411904P5 25 Slides

GATA3 CytoSection

Sign In for Pricing
View Details