Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBTD2 Peptide - C-terminal region

UBTD2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DCUBP, MGC30022

UniProt

Q8WUN7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_689490

Preservative

Lyophilized powder

AA Sequence

TDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Six4 Mouse Gene Knockout Kit (CRISPR)
KN515814 1 Kit

Six4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ICOSLG/B7-H2/CD275 Recombinant Rabbit monoclonal Antibody
HA723322B 100 µL

Human ICOSLG/B7-H2/CD275 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Guca2b (NM_008191) Mouse Tagged ORF Clone
MG200368 10 µg

Guca2b (NM_008191) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
EZ-Link NHS-PEG12-Biotin
TRC-N394010-25MG 25 mg

EZ-Link NHS-PEG12-Biotin

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/3085), 0.2mg/mL
BNUB3085-100 1x 100 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/3085), 0.2mg/mL

Sign In for Pricing
View Details
Ethylcarbamic Acid 4-Nitrophenyl Ester
TRC-E900880-25G 25 g

Ethylcarbamic Acid 4-Nitrophenyl Ester

Sign In for Pricing
View Details