Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBTD2 Peptide - C-terminal region

UBTD2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DCUBP, MGC30022

UniProt

Q8WUN7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_689490

Preservative

Lyophilized powder

AA Sequence

TDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRI1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9H7]
TA500491AM 100 µL

MRI1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9H7]

Sign In for Pricing
View Details
FMOC-Lys (5/6-TAMRA) -OH
5044-AAT 100 mg

FMOC-Lys (5/6-TAMRA) -OH

Sign In for Pricing
View Details
Human C17orf61 (TMEM256) activation kit by CRISPRa
GA116797 1 Kit

Human C17orf61 (TMEM256) activation kit by CRISPRa

Sign In for Pricing
View Details
Laminin 5 (LAMB3) (NM_000228) Human Over-expression Lysate
LY424856 100 µg

Laminin 5 (LAMB3) (NM_000228) Human Over-expression Lysate

Sign In for Pricing
View Details
GNAT2 (NM_005272) Human Over-expression Lysate
LC401620 20 µg

GNAT2 (NM_005272) Human Over-expression Lysate

Sign In for Pricing
View Details
TGFalpha (TG86), CF594 conjugate, 0.1mg/mL
BNC940786-100 1x 100 µL

TGFalpha (TG86), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details