Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBXD3 Peptide - middle region

UBXD3 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ25429, UBXD3

UniProt

Q96LJ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBXD3 Rabbit Polyclonal Antibody (orb325806) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689589

Preservative

Lyophilized powder

AA Sequence

PYELPSSQKPGACAPKSPNQGASDEIPELQQQVPTGASSSLNKYPVLPSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oxazole-4-carbohydrazide
TRC-E588903-500MG 500 mg

Oxazole-4-carbohydrazide

Sign In for Pricing
View Details
Oct4 (POU5F1) Mouse Monoclonal Antibody [Clone ID: C-10]
AM10125SU-N 1 mL

Oct4 (POU5F1) Mouse Monoclonal Antibody [Clone ID: C-10]

Sign In for Pricing
View Details
Sumo 1 (SUMO1) (NM_001005781) Human Recombinant Protein
TP720153M 50 µg

Sumo 1 (SUMO1) (NM_001005781) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Crem activation kit by CRISPRa
GA200870 1 Kit

Mouse Crem activation kit by CRISPRa

Sign In for Pricing
View Details
Ndufc1 (NM_025523) Mouse Tagged ORF Clone
MG200104 10 µg

Ndufc1 (NM_025523) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
H3FT (HIST3H3) Rabbit Polyclonal Antibody
TA384389 100 µL

H3FT (HIST3H3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details