Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBXD3 Peptide - middle region

UBXD3 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ25429, UBXD3

UniProt

Q96LJ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBXD3 Rabbit Polyclonal Antibody (orb325806) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689589

Preservative

Lyophilized powder

AA Sequence

PYELPSSQKPGACAPKSPNQGASDEIPELQQQVPTGASSSLNKYPVLPSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAMR1 Mouse Monoclonal Antibody [Clone ID: OTI4E2]
CF809285 100 µg

PAMR1 Mouse Monoclonal Antibody [Clone ID: OTI4E2]

Sign In for Pricing
View Details
Neurofascin (NFASC) (NM_001160331) Human Recombinant Protein
TP328652L 1 mg

Neurofascin (NFASC) (NM_001160331) Human Recombinant Protein

Sign In for Pricing
View Details
N10-Trifluoroacetylpteroic Acid
TRC-T789700-500MG 500 mg

N10-Trifluoroacetylpteroic Acid

Sign In for Pricing
View Details
Anti-KIAA0317
Y158000 100 µg

Anti-KIAA0317

Sign In for Pricing
View Details
C11orf97 (NM_001190462) Human Over-expression Lysate
LY433961 100 µg

C11orf97 (NM_001190462) Human Over-expression Lysate

Sign In for Pricing
View Details
Isophthalic Acid
TRC-I822008-250MG 250 mg

Isophthalic Acid

Sign In for Pricing
View Details