Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubxn2a Peptide - middle region

Ubxn2a Peptide - middle region

Product Specifications

Product Name Alternative

Ubxd4

UniProt

D3ZID8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ubxn2a Rabbit Polyclonal Antibody (orb582065) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102952

Preservative

Lyophilized powder

AA Sequence

VCMSTKPVFQPFSGQGHRLGSATPRIVSKAKSIEVDNKSTLSAVSLNNLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cfi Pre-designed siRNA Set A
SI102474A 1 Each

Mouse Cfi Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse Monoclonal CD43/Sialophorin Antibody (84-3C1) [DyLight 650]
NBP3-11445C 0.1 mL

Mouse Monoclonal CD43/Sialophorin Antibody (84-3C1) [DyLight 650]

Sign In for Pricing
View Details
3-Hydroxyisobutyryl-CoA Hydrolase, Mitochondrial (HIBCH) Antibody
abx033393-01 80 µL

3-Hydroxyisobutyryl-CoA Hydrolase, Mitochondrial (HIBCH) Antibody

Sign In for Pricing
View Details
3-Hydroxyisobutyryl-CoA Hydrolase, Mitochondrial (HIBCH) Antibody
abx033393-02 400 µL

3-Hydroxyisobutyryl-CoA Hydrolase, Mitochondrial (HIBCH) Antibody

Sign In for Pricing
View Details
Estrogen receptor alpha Polyclonal Antibody
bs-0254R 100 µL

Estrogen receptor alpha Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) TY2B-GR1 Polyclonal Antibody
MBS7190551 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) TY2B-GR1 Polyclonal Antibody

Sign In for Pricing
View Details