Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubxn2a Peptide - middle region

Ubxn2a Peptide - middle region

Product Specifications

Product Name Alternative

Ubxd4

UniProt

D3ZID8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ubxn2a Rabbit Polyclonal Antibody (orb582065) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102952

Preservative

Lyophilized powder

AA Sequence

VCMSTKPVFQPFSGQGHRLGSATPRIVSKAKSIEVDNKSTLSAVSLNNLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZIC1 (Zic Family Member 1 (odd-Paired Homolog, Drosophila), ZIC, ZNF201) (MaxLight 405) discontinued
253612-ML405 100 µL

ZIC1 (Zic Family Member 1 (odd-Paired Homolog, Drosophila), ZIC, ZNF201) (MaxLight 405) discontinued

Sign In for Pricing
View Details
MSGN1 Rabbit pAb, PE-Cy5.5 conjugated
orb2856376 100 µL

MSGN1 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
SATB2 (G-11) : m-IgGκ BP-HRP Bundle
sc-525320 1 Kit

SATB2 (G-11) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
IgG, H&L, X-Adsorbed (AP)
I1904-48Y 500 µg

IgG, H&L, X-Adsorbed (AP)

Sign In for Pricing
View Details
VILL Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV716694 1.0 µg DNA

VILL Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
C20orf4 3'UTR Lenti-reporter-Luc Vector
14305081 1.0 µg

C20orf4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details