Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubxn2a Peptide - middle region

Ubxn2a Peptide - middle region

Product Specifications

Product Name Alternative

Ubxd4

UniProt

D3ZID8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ubxn2a Rabbit Polyclonal Antibody (orb582065) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102952

Preservative

Lyophilized powder

AA Sequence

VCMSTKPVFQPFSGQGHRLGSATPRIVSKAKSIEVDNKSTLSAVSLNNLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Bromo-3,5-difluorophenol
sc-259594A 5 g

2-Bromo-3,5-difluorophenol

Sign In for Pricing
View Details
Rabbit anti-ITIH4 Antibody
DL98913A-01 50 µL

Rabbit anti-ITIH4 Antibody

Sign In for Pricing
View Details
Rabbit anti-ITIH4 Antibody
DL98913A-02 100 µL

Rabbit anti-ITIH4 Antibody

Sign In for Pricing
View Details
Slc39a10 Rat shRNA Plasmid (Locus ID 363229)
TR707325 1 Kit

Slc39a10 Rat shRNA Plasmid (Locus ID 363229)

Sign In for Pricing
View Details
Cesium Trifluoroacetate
TRC-C280013-500MG 500 mg

Cesium Trifluoroacetate

Sign In for Pricing
View Details
OTUB2 Mouse Monoclonal Antibody [Clone ID: OTI2F6]
TA501944S 30 µL

OTUB2 Mouse Monoclonal Antibody [Clone ID: OTI2F6]

Sign In for Pricing
View Details