Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBXN6 Peptide - C-terminal region

UBXN6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp667D109, FLJ00394, UBXD1, UBXDC2

UniProt

Q9BZV1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBXN6 Rabbit Polyclonal Antibody (orb584285) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001164562

Preservative

Lyophilized powder

AA Sequence

YARERLGAVYGFVREALQSDWLPFELLASGGQKLSEDENLALNECGLVPS

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Acetoacetyl-CoA Synthetase (AACS) ELISA Kit
abx390917 96 Tests

Rat Acetoacetyl-CoA Synthetase (AACS) ELISA Kit

Sign In for Pricing
View Details
Elastase-2B siRNA (h)
sc-105327 10 µM

Elastase-2B siRNA (h)

Sign In for Pricing
View Details
Eprosartan
E4951-100mg 100 mg

Eprosartan

Sign In for Pricing
View Details
Rabbit Monoclonal Glutathione Reductase Antibody (S09-5A9)
NBP3-19647-50ul 50 µL

Rabbit Monoclonal Glutathione Reductase Antibody (S09-5A9)

Sign In for Pricing
View Details
C1orf158 (NM_152290) Human Tagged Lenti ORF Clone
RC206726L3 10 µg

C1orf158 (NM_152290) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Tert-Butyl 3-hydroxy-8-azabicyclo[3.2.1]octane-8-carboxylate
OR89974-01 1 g

Tert-Butyl 3-hydroxy-8-azabicyclo[3.2.1]octane-8-carboxylate

Sign In for Pricing
View Details