Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL1 Peptide - C-terminal region

UCHL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PARK5, PGP9.5, PGP95, Uch-L1, PGP 9.5

UniProt

P09936

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UCHL1 Rabbit Polyclonal Antibody (orb331010) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_004172

Preservative

Lyophilized powder

AA Sequence

HLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PA1 (H-1) PE
sc-393387 PE 200 µg/mL

PA1 (H-1) PE

Sign In for Pricing
View Details
Monkey NO ELISA Kit
EMKN0048 96 Tests

Monkey NO ELISA Kit

Sign In for Pricing
View Details
Mup1 (NM_031188) Mouse Tagged ORF Clone
MG201618 10 µg

Mup1 (NM_031188) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
BRCC3 (Lys-63-specific Deubiquitinase BRCC36, BRCA1/BRCA2-Containing Complex Subunit 3)
476348 100 µL

BRCC3 (Lys-63-specific Deubiquitinase BRCC36, BRCA1/BRCA2-Containing Complex Subunit 3)

Sign In for Pricing
View Details
Anti-VIM/Vimentin Antibody (R3B18)
RHC35309 100 μg

Anti-VIM/Vimentin Antibody (R3B18)

Sign In for Pricing
View Details
MAGUK P55 Subfamily Member 6 (MPP6) Antibody
abx126183-01 20 µL

MAGUK P55 Subfamily Member 6 (MPP6) Antibody

Sign In for Pricing
View Details