Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL1 Peptide - C-terminal region

UCHL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PARK5, PGP9.5, PGP95, Uch-L1, PGP 9.5

UniProt

P09936

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UCHL1 Rabbit Polyclonal Antibody (orb331010) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_004172

Preservative

Lyophilized powder

AA Sequence

HLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTBD6 Antibody - middle region : HRP (ARP39757_P050-HRP)
ARP39757_P050-HRP 100 µL

BTBD6 Antibody - middle region : HRP (ARP39757_P050-HRP)

Sign In for Pricing
View Details
GSK2256098
C13467-5mg 5 mg

GSK2256098

Sign In for Pricing
View Details
SIAH3 Rabbit Polyclonal Antibody (BF647)
orb2489533 100 µL

SIAH3 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
C10orf57 (TMEM254) (NM_001270373) Human Untagged Clone
SC330815 10 µg

C10orf57 (TMEM254) (NM_001270373) Human Untagged Clone

Sign In for Pricing
View Details
Major Pollen Allergen Art v 1 Protein
B2012727 250 µg

Major Pollen Allergen Art v 1 Protein

Sign In for Pricing
View Details
GPR75 rabbit pAb
ES4573-01 50 µL

GPR75 rabbit pAb

Sign In for Pricing
View Details