Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL1 Peptide - C-terminal region

UCHL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PARK5, PGP9.5, PGP95, Uch-L1, PGP 9.5

UniProt

P09936

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UCHL1 Rabbit Polyclonal Antibody (orb331031) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_004172

Preservative

Lyophilized powder

AA Sequence

ELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recoverin (h) -PR
sc-40905-PR 10 µM - 20 µL

Recoverin (h) -PR

Sign In for Pricing
View Details
Recombinant Aliivibrio salmonicida Probable molybdopterin-guanine dinucleotide biosynthesis protein A (mobA)
MBS1023700-01 0.02 mg (E-Coli)

Recombinant Aliivibrio salmonicida Probable molybdopterin-guanine dinucleotide biosynthesis protein A (mobA)

Sign In for Pricing
View Details
Recombinant Aliivibrio salmonicida Probable molybdopterin-guanine dinucleotide biosynthesis protein A (mobA)
MBS1023700-02 0.1 mg (E-Coli)

Recombinant Aliivibrio salmonicida Probable molybdopterin-guanine dinucleotide biosynthesis protein A (mobA)

Sign In for Pricing
View Details
Recombinant Aliivibrio salmonicida Probable molybdopterin-guanine dinucleotide biosynthesis protein A (mobA)
MBS1023700-03 0.02 mg (Yeast)

Recombinant Aliivibrio salmonicida Probable molybdopterin-guanine dinucleotide biosynthesis protein A (mobA)

Sign In for Pricing
View Details
Recombinant Aliivibrio salmonicida Probable molybdopterin-guanine dinucleotide biosynthesis protein A (mobA)
MBS1023700-04 0.1 mg (Yeast)

Recombinant Aliivibrio salmonicida Probable molybdopterin-guanine dinucleotide biosynthesis protein A (mobA)

Sign In for Pricing
View Details
Recombinant Aliivibrio salmonicida Probable molybdopterin-guanine dinucleotide biosynthesis protein A (mobA)
MBS1023700-05 0.02 mg (Baculovirus)

Recombinant Aliivibrio salmonicida Probable molybdopterin-guanine dinucleotide biosynthesis protein A (mobA)

Sign In for Pricing
View Details