Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL1 Peptide - C-terminal region

UCHL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PARK5, PGP9.5, PGP95, Uch-L1, PGP 9.5

UniProt

P09936

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UCHL1 Rabbit Polyclonal Antibody (orb331031) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_004172

Preservative

Lyophilized powder

AA Sequence

ELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHLDA1 Protein Vector (Mouse) (pPB-C-His)
PV215794 500 ng

PHLDA1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Txlng 3'UTR Luciferase Stable Cell Line
TU222687 1.0 mL

Txlng 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
FAM33A Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV813242 1.0 µg DNA

FAM33A Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
(3β,5β,7α,12α) -3,7,12-Trihydroxycholan-2,2,3,4,4-d5-24-oic Acid Methyl Ester
428297-01 1 mg

(3β,5β,7α,12α) -3,7,12-Trihydroxycholan-2,2,3,4,4-d5-24-oic Acid Methyl Ester

Sign In for Pricing
View Details
(3β,5β,7α,12α) -3,7,12-Trihydroxycholan-2,2,3,4,4-d5-24-oic Acid Methyl Ester
428297-02 2.5 mg

(3β,5β,7α,12α) -3,7,12-Trihydroxycholan-2,2,3,4,4-d5-24-oic Acid Methyl Ester

Sign In for Pricing
View Details
IGF1 Peptide
DF6096-BP 1 mg

IGF1 Peptide

Sign In for Pricing
View Details