Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL3 Peptide - C-terminal region

UCHL3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

UCH-L3

UniProt

P15374

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UCHL3 Rabbit Polyclonal Antibody (orb584289) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005993

Preservative

Lyophilized powder

AA Sequence

YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Indigo Carmine 5,7'-Isomer (~90%)
TRC-I521175-5MG 5 mg

Indigo Carmine 5,7'-Isomer (~90%)

Sign In for Pricing
View Details
CD1a (O10 + C1A/711), 0.2mg/mL
BNUB0717-100 1x 100 µL

CD1a (O10 + C1A/711), 0.2mg/mL

Sign In for Pricing
View Details
1-Chlorohexan-2-one
TRC-C611068-50MG 50 mg

1-Chlorohexan-2-one

Sign In for Pricing
View Details
Iso Imperatorin
TRC-I820150-10MG 10 mg

Iso Imperatorin

Sign In for Pricing
View Details
HLA-DRB (LN-3), CF594 conjugate, 0.1mg/mL
BNC940057-500 1x 500 µL

HLA-DRB (LN-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Rat Interleukin-12/IL-12 Protein (His Tag)
PDMR100002-01 20 µg

Recombinant Rat Interleukin-12/IL-12 Protein (His Tag)

Sign In for Pricing
View Details