Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL3 Peptide - C-terminal region

UCHL3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

UCH-L3

UniProt

P15374

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UCHL3 Rabbit Polyclonal Antibody (orb584289) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005993

Preservative

Lyophilized powder

AA Sequence

YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Menthyl Acetate
TRC-M218716-250MG 250 mg

Menthyl Acetate

Sign In for Pricing
View Details
Ethyl Isodehydroacetate
TRC-E921350-25G 25 g

Ethyl Isodehydroacetate

Sign In for Pricing
View Details
YAP1 Human Gene Knockout Kit (CRISPR)
KN214393 1 Kit

YAP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GIT2 Rabbit Polyclonal Antibody
AP06730PU-N 100 µg

GIT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1700012B09Rik (NM_029306) Mouse Tagged ORF Clone
MG200593 10 µg

1700012B09Rik (NM_029306) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
14-3-3 epsilon (YWHAE) (NM_006761) Human Recombinant Protein
TP720511 10 µg

14-3-3 epsilon (YWHAE) (NM_006761) Human Recombinant Protein

Sign In for Pricing
View Details