Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL5 Peptide - C-terminal region

UCHL5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CGI-70, INO80R, UCH37, UCH-L5

UniProt

Q9Y5K5

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UCHL5 Rabbit Polyclonal Antibody (orb584287) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057068

Preservative

Lyophilized powder

AA Sequence

KRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX6 Blocking Peptide
3636BP-50 50 μg

PAX6 Blocking Peptide

Sign In for Pricing
View Details
STX19 Antibody - N-terminal region : FITC (ARP56145_P050-FITC)
ARP56145_P050-FITC 100 µL

STX19 Antibody - N-terminal region : FITC (ARP56145_P050-FITC)

Sign In for Pricing
View Details
ELOVL2 (NM_017770) Human Tagged ORF Clone Lentiviral Particle
RC209232L2V 200 µL

ELOVL2 (NM_017770) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Starter Kit D/ Nucleic Acid
CAC-DCB-303111SETD 1 Set

Starter Kit D/ Nucleic Acid

Sign In for Pricing
View Details
Mouse Immunoglobulin D,IgD ELISA KIT
JOT-EK1771Mo-01 96 Well

Mouse Immunoglobulin D,IgD ELISA KIT

Sign In for Pricing
View Details
Mouse Immunoglobulin D,IgD ELISA KIT
JOT-EK1771Mo-02 48 Well

Mouse Immunoglobulin D,IgD ELISA KIT

Sign In for Pricing
View Details