Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL5 Peptide - C-terminal region

UCHL5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CGI-70, INO80R, UCH37, UCH-L5

UniProt

Q9Y5K5

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UCHL5 Rabbit Polyclonal Antibody (orb584287) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057068

Preservative

Lyophilized powder

AA Sequence

KRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Hdac2 shRNA (UAS) - Lentiviral mouse Hdac2 shRNA (UAS, iRFP) plasmid
GTR15276124 1 Vial

Lentiviral mouse Hdac2 shRNA (UAS) - Lentiviral mouse Hdac2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Rabbit anti-PHKB Antibody Affinity Purified
MBS3908053-01 0.01 mg

Rabbit anti-PHKB Antibody Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-PHKB Antibody Affinity Purified
MBS3908053-02 5x 0.01 mg

Rabbit anti-PHKB Antibody Affinity Purified

Sign In for Pricing
View Details
Avagacestat
6363/25 25 mg

Avagacestat

Sign In for Pricing
View Details
n-Dodecyl-b-D-maltoside
P-1170.0025 25.0g

n-Dodecyl-b-D-maltoside

Sign In for Pricing
View Details
GPR88, CT (GPR88, STRG, Probable G-protein coupled receptor 88, Striatum-specific G-protein coupled receptor) (Biotin)
MBS6304076-01 0.2 mL

GPR88, CT (GPR88, STRG, Probable G-protein coupled receptor 88, Striatum-specific G-protein coupled receptor) (Biotin)

Sign In for Pricing
View Details