Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UFD1 Peptide - middle region

UFD1 Peptide - middle region

Product Specifications

Product Name Alternative

UFD1L

UniProt

Q92890

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_005650

Preservative

Lyophilized powder

AA Sequence

NYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERQVQHEEST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon
CS806546 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
DGAT1 (67-79) Goat Polyclonal Antibody
AP32857PU-N 100 µg

DGAT1 (67-79) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Rat IgG2a (1-1) In Vivo Isotype Control Low Endotoxin
ICH2244-5mg 5 mg

Rat IgG2a (1-1) In Vivo Isotype Control Low Endotoxin

Sign In for Pricing
View Details
Human IL-7, C-His, Flag Tag
HA210595-01 20 µg

Human IL-7, C-His, Flag Tag

Sign In for Pricing
View Details
Human IL-7, C-His, Flag Tag
HA210595-02 50 µg

Human IL-7, C-His, Flag Tag

Sign In for Pricing
View Details
Human IL-7, C-His, Flag Tag
HA210595-03 100 µg

Human IL-7, C-His, Flag Tag

Sign In for Pricing
View Details