Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UFM1 Peptide - middle region

UFM1 Peptide - middle region

Product Specifications

Product Name Alternative

BM-002, C13orf20, bA131P10.1

UniProt

P61960

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_057701

Preservative

Lyophilized powder

AA Sequence

LSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRG4 (NM_138573) Human Over-expression Lysate
LC403362 20 µg

NRG4 (NM_138573) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant PON1 Antibody
RN-047-01 50 μL

Recombinant PON1 Antibody

Sign In for Pricing
View Details
Recombinant PON1 Antibody
RN-047-02 100 µL

Recombinant PON1 Antibody

Sign In for Pricing
View Details
Recombinant PON1 Antibody
RN-047-03 1 mL

Recombinant PON1 Antibody

Sign In for Pricing
View Details
Isopropyl Diphenyl Phosphate-d7
TRC-I824472-10MG 10 mg

Isopropyl Diphenyl Phosphate-d7

Sign In for Pricing
View Details
Mouse Thrombopoietin / TPO, C-His Tag
HA211311-01 20 µg

Mouse Thrombopoietin / TPO, C-His Tag

Sign In for Pricing
View Details