Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UFM1 Peptide - middle region

UFM1 Peptide - middle region

Product Specifications

Product Name Alternative

BM-002, C13orf20, bA131P10.1

UniProt

P61960

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_057701

Preservative

Lyophilized powder

AA Sequence

LSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD56 Mouse Monoclonal Antibody [Clone ID: LT56]
AM26771AC-N 100 Tests

CD56 Mouse Monoclonal Antibody [Clone ID: LT56]

Sign In for Pricing
View Details
Nampt Mouse Gene Knockout Kit (CRISPR)
KN310718LP 1 Kit

Nampt Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD79a (IGA/515), Biotin conjugate, 0.1mg/mL
BNCB0515-100 1x 100 µL

CD79a (IGA/515), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RUNX2 Mouse Monoclonal Antibody [Clone ID: 1D2]
AM20584PU-N 50 µg

RUNX2 Mouse Monoclonal Antibody [Clone ID: 1D2]

Sign In for Pricing
View Details
Tissue Protein Lysate, Lung
CP565447 150 µg

Tissue Protein Lysate, Lung

Sign In for Pricing
View Details
TPB
SFC-15 5 g

TPB

Sign In for Pricing
View Details