Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGCGL1 Peptide - middle region

UGCGL1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ23671, FLJ23796, HUGT1, UGT1, UGCGL1

UniProt

A8KAK1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UGCGL1 Rabbit Polyclonal Antibody (orb580743) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020948

Preservative

Lyophilized powder

AA Sequence

AAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Escherichia coli (E. coli) (Biotin) discontinued
E3500-04L 1 mL

Escherichia coli (E. coli) (Biotin) discontinued

Sign In for Pricing
View Details
Biotinylated Anti-UCHL1 antibody (2G7), Rabbit mAb
E33E100266B 100 µL

Biotinylated Anti-UCHL1 antibody (2G7), Rabbit mAb

Sign In for Pricing
View Details
IGKV1D-12 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV764805 1.0 µg DNA

IGKV1D-12 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant Human VIP Protein, N-His
orb2969659-01 50 µg

Recombinant Human VIP Protein, N-His

Sign In for Pricing
View Details
Recombinant Human VIP Protein, N-His
orb2969659-02 100 µg

Recombinant Human VIP Protein, N-His

Sign In for Pricing
View Details
Recombinant Human VIP Protein, N-His
orb2969659-03 1 mg

Recombinant Human VIP Protein, N-His

Sign In for Pricing
View Details