Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGCGL1 Peptide - middle region

UGCGL1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ23671, FLJ23796, HUGT1, UGT1, UGCGL1

UniProt

A8KAK1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UGCGL1 Rabbit Polyclonal Antibody (orb580743) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020948

Preservative

Lyophilized powder

AA Sequence

AAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPO Antibody / Myeloperoxidase
V4526SAF-100UG 100 µg

MPO Antibody / Myeloperoxidase

Sign In for Pricing
View Details
Mouse CD258/TNFSF14/LIGHT Recombinant Protein
PPT-16369 100 µg

Mouse CD258/TNFSF14/LIGHT Recombinant Protein

Sign In for Pricing
View Details
FAM42B ORF Vector (Human) (pORF)
ORF019344 1.0 µg DNA

FAM42B ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Anti-IL-13 Antibody (8X541)
TMAY-00710 100 µL

Anti-IL-13 Antibody (8X541)

Sign In for Pricing
View Details
SULT4A1 Protein Vector (Human) (pPM-C-HA)
PV040827 500 ng

SULT4A1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Galanin (1-13)-Substance P (5-11) amide
H-1312.0500 0.5mg

Galanin (1-13)-Substance P (5-11) amide

Sign In for Pricing
View Details