Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGDH Peptide - C-terminal region

UGDH Peptide - C-terminal region

Product Specifications

Product Name Alternative

GDH, UDP-GlcDH, UDPGDH, UGD

UniProt

O60701

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UGDH Rabbit Polyclonal Antibody (orb584948) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003350

Preservative

Lyophilized powder

AA Sequence

VLDGLHNELQTIGFQIETIGKKVSSKRIPYAPSGEIPKFSLQDPPNKKPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FTSJD1 (CMTR2) activation kit by CRISPRa
GA110965 1 Kit

Human FTSJD1 (CMTR2) activation kit by CRISPRa

Sign In for Pricing
View Details
TNFRSF1B (N-term) Rabbit Polyclonal Antibody
AP23408PU-N 100 µg

TNFRSF1B (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2718), CF647 conjugate, 0.1mg/mL
BNC472718-500 1x 500 µL

PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2718), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Cox7a1 activation kit by CRISPRa
GA200844 1 Kit

Mouse Cox7a1 activation kit by CRISPRa

Sign In for Pricing
View Details
Tbc1d17 Mouse Gene Knockout Kit (CRISPR)
KN517242 1 Kit

Tbc1d17 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS625513 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details