Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGDH Peptide - C-terminal region

UGDH Peptide - C-terminal region

Product Specifications

Product Name Alternative

GDH, UDP-GlcDH, UDPGDH, UGD

UniProt

O60701

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UGDH Rabbit Polyclonal Antibody (orb584948) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003350

Preservative

Lyophilized powder

AA Sequence

VLDGLHNELQTIGFQIETIGKKVSSKRIPYAPSGEIPKFSLQDPPNKKPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horseradish Peroxidase Conjugated Rabbit Affinity Purified Antibody to Mouse IgG
HAF-541-1 1 mL

Horseradish Peroxidase Conjugated Rabbit Affinity Purified Antibody to Mouse IgG

Sign In for Pricing
View Details
MAP4K4 Mouse Monoclonal Antibody [Clone ID: 4H9E7]
AM06248SU-N 100 µL

MAP4K4 Mouse Monoclonal Antibody [Clone ID: 4H9E7]

Sign In for Pricing
View Details
Human CHRNA9 activation kit by CRISPRa
GA110802 1 Kit

Human CHRNA9 activation kit by CRISPRa

Sign In for Pricing
View Details
HSPA1A Antibody
KC-6241-01 50 μL

HSPA1A Antibody

Sign In for Pricing
View Details
HSPA1A Antibody
KC-6241-02 100 µL

HSPA1A Antibody

Sign In for Pricing
View Details
HSPA1A Antibody
KC-6241-03 1 mL

HSPA1A Antibody

Sign In for Pricing
View Details